Pfam domain
Pfam family: Ribosomal_L11 (PF00298.18)
Uniprot AC: P29395
RecName: 50S ribosomal protein L11
Begin-End: 71-139
Organism: Thermotoga maritima
Interaction Mode:   

Sequence:
KTPPASFLLKKAAGIEKGSSEPKRKIVGKVTRKQIEEIAKTKMPDLNANSLEAAMKIIEG
TAKSMGIEV
Structures of the domain P29395 71-139
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1eg0 X-ray 11.5 K 64-132 None
1pn7 X-ray 10.8 L 71-139 None
1r2w X-ray 9 A 67-133 None
1pn8 X-ray 10.8 L 71-139 None
1ml5 X-ray 14 l 71-139 None
1mms X-ray 2.57 B 71-139 None
1mms X-ray 2.57 A 71-139 None
1oln X-ray 0 A 71-139 None
2jq7 NMR A 71-139 None
1r2x X-ray 9 A 67-133 None
1mvr X-ray 12.8 L 71-139 None
1mj1 X-ray 13 L 64-132 None


© NPIDB team 2003 - 2019

text