Pfam domain
Pfam family: Ribosomal_L11_N (PF03946.13)
Uniprot AC: P29395
RecName: 50S ribosomal protein L11
Begin-End: 8-66
Organism: Thermotoga maritima
Interaction Mode:   

Sequence:
QIKLQLPAGKATPAPPVGPALGQHGVNIMEFCKRFNAETADKAGMILPVVITVYEDKSF
Structures of the domain P29395 8-66
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1eg0 X-ray 11.5 K 2-59 None
1pn7 X-ray 10.8 L 9-66 None
1r2w X-ray 9 A 2-59 None
1pn8 X-ray 10.8 L 9-66 None
1ml5 X-ray 14 l 9-66 None
1mms X-ray 2.57 A 9-66 None
1oln X-ray 0 A 9-66 None
2jq7 NMR A 9-66 None
1r2x X-ray 9 A 2-59 None
1mvr X-ray 12.8 L 9-66 None
1mj1 X-ray 13 L 2-59 None


© NPIDB team 2003 - 2019

text