Pfam domain
Pfam family: NTP_transf_2 (PF01909.22)
Uniprot AC: P29468
RecName: Poly(A) polymerase
Begin-End: 69-161
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
KKNMSDGMARDAGGKIFTYGSYRLGVHGPGSDIDTLVVVPKHVTREDFFTVFDSLLRERK
ELDEIAPVPDAFVPIIKIKFSGISIDLICARLD
Structures of the domain P29468 69-161
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2q66 X-ray 1.8 A 81-153 None


© NPIDB team 2003 - 2019

text