Pfam domain
Pfam family: PAP_central (PF04928.16)
Uniprot AC: P29468
RecName: Poly(A) polymerase
Begin-End: 8-351
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
GITGPVSTVGATAAENKLNDSLIQELKKEGSFETEQETANRVQVLKILQELAQRFVYEVS
KKKNMSDGMARDAGGKIFTYGSYRLGVHGPGSDIDTLVVVPKHVTREDFFTVFDSLLRER
KELDEIAPVPDAFVPIIKIKFSGISIDLICARLDQPQVPLSLTLSDKNLLRNLDEKDLRA
LNGTRVTDEILELVPKPNVFRIALRAIKLWAQRRAVYANIFGFPGGVAWAMLVARICQLY
PNACSAVILNRFFIILSEWNWPQPVILKPIEDGPLQVRVWNPKIYAQDRSHRMPVITPAY
PSMCATHNITESTKKVILQEFVRGVQITNDIFSNKKSWANLFEK
Structures of the domain P29468 8-351
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2q66 X-ray 1.8 A 8-351 None


© NPIDB team 2003 - 2019

text