Pfam domain
Pfam family: RNase_T (PF00929.23)
Uniprot AC: P30014
RecName: Ribonuclease T
Begin-End: 20-194
Organism: Escherichia coli
Interaction Mode:   

Sequence:
VVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHFHVEPFVGANLQPEALAFNG
IDPNDPDRGAVSEYEALHEIFKVVRKGIKASGCNRAIMVAHNANFDHSFMMAAAERASLK
RNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLF
Structures of the domain P30014 20-194
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3nh0 X-ray 2.3 A 20-194 None
3nh0 X-ray 2.3 B 20-194 None
3nh1 X-ray 2.11 C 20-194 None
3nh1 X-ray 2.11 D 20-194 None
3nh1 X-ray 2.11 B 20-194 None
3nh1 X-ray 2.11 A 20-194 None
3ngz X-ray 2.1 A 20-194 None
3ngz X-ray 2.1 B 20-194 None
3nh2 X-ray 2.3 F 20-194 None
3nh2 X-ray 2.3 E 20-194 None
3nh2 X-ray 2.3 A 20-194 None
3nh2 X-ray 2.3 B 20-194 None
3nh2 X-ray 2.3 F 20-194 None
3nh2 X-ray 2.3 E 20-194 None
3nh2 X-ray 2.3 B 20-194 None
3nh2 X-ray 2.3 A 20-194 None
3v9z X-ray 1.8 A 20-194 None
3v9z X-ray 1.8 B 20-194 None
3v9u X-ray 2.3 C 20-194 None
3v9u X-ray 2.3 D 20-194 None
3v9u X-ray 2.3 B 20-194 None
3v9u X-ray 2.3 A 20-194 None
3va3 X-ray 2.71 A 20-194 None
3va3 X-ray 2.71 B 20-194 None
3v9x X-ray 1.9 A 20-194 None
3v9x X-ray 1.9 B 20-194 None
3v9x X-ray 1.9 D 20-194 None
3v9x X-ray 1.9 C 20-194 None
3v9s X-ray 2.1 A 20-194 None
3v9s X-ray 2.1 B 20-194 None
3v9w X-ray 1.7 A 20-194 None
3v9w X-ray 1.7 B 20-194 None
3v9w X-ray 1.7 C 20-194 None
3v9w X-ray 1.7 D 20-194 None
4kb1 X-ray 1.8 A 20-194 None
4kb1 X-ray 1.8 B 20-194 None
4kaz X-ray 1.9 A 20-194 None
4kb0 X-ray 2 B 20-194 None
4kb0 X-ray 2 A 20-194 None


© NPIDB team 2003 - 2019

text