Pfam domain
Pfam family: Ribosomal_L11_N (PF03946.13)
Uniprot AC: P30050
RecName: 60S ribosomal protein L12
Begin-End: 7-69
Organism: Homo sapiens
Interaction Mode:   

Sequence:
PNEIKVVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKATGDWKGLRITVKLTIQN
RQA
Structures of the domain P30050 7-69
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5a8l X-ray 3.8 G 13-69 None


© NPIDB team 2003 - 2019

text