Pfam domain
Pfam family: UPF1_Zn_bind (PF09416.9)
Uniprot AC: P30771
RecName: ATP-dependent helicase NAM7
Begin-End: 60-208
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
NSCAYCGIDSAKCVIKCNSCKKWFCNTKNGTSSSHIVNHLVLSHHNVVSLHPDSDLGDTV
LECYNCGRKNVFLLGFVSAKSEAVVVLLCRIPCAQTKNANWDTDQWQPLIEDRQLLSWVA
EQPTEEEKLKARLITPSQISKLEAKWRSN
Structures of the domain P30771 60-208
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2xzl X-ray 2.4 A 61-208 None


© NPIDB team 2003 - 2019

text