Pfam domain
Pfam family: RNA_pol_Rpb2_5 (PF04567.16)
Uniprot AC: P30876
RecName: DNA-directed RNA polymerase II subunit RPB2
Begin-End: 653-700
Organism: Homo sapiens
Interaction Mode:   

Sequence:
WQDLVASGVVEYIDTLEEETVMLAMTPDDLQEKEVAYCSTYTHCEIHP
Structures of the domain P30876 653-700
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5iy7 X-ray 8.6 B 653-700 None
5iya X-ray 5.4 B 653-700 None
5iy8 X-ray 7.9 B 653-700 None
5iyd X-ray 3.9 B 653-700 None
5iy6 X-ray 7.2 B 653-700 None
5iyc X-ray 3.9 B 653-700 None
5iy9 X-ray 6.3 B 653-700 None
5iyb X-ray 3.9 B 653-700 None


© NPIDB team 2003 - 2019

text