Pfam domain
Pfam family: Ribosomal_L11_N (PF03946.13)
Uniprot AC: P31164
RecName: 50S ribosomal protein L11, chloroplastic
Begin-End: 79-137
Organism: Spinacia oleracea
Interaction Mode:   

Sequence:
VIKLALEAGKATPAPPVGPALGSKGVNIMAFCKDYNARTADKPGFVIPVEITVFDDKSF
Structures of the domain P31164 79-137
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5mmi X-ray 3.25 J 80-137 None


© NPIDB team 2003 - 2019

text