Pfam domain
Pfam family: BTD (PF09270.12)
Uniprot AC: P31266
RecName: Recombining binding protein suppressor of hairless
Begin-End: 232-354
Organism: Mus musculus
Interaction Mode:  S-Bb L-Bb 

Sequence:
EGGNFHASSQQWGAFYIHLLDDDESEGEEFTVRDGYIHYGQTVKLVCSVTGMALPRLIIR
KVDKQTALLDADDPVSQLHKCAFYLKDTERMYLCLSQERIIQFQATPCPKEQNKEMINDG
ASW
Structures of the domain P31266 232-354
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4j2x X-ray 2.85 C 232-354  S-Bb 
4j2x X-ray 2.85 A 232-354  S-Bb L-Bb 
3brg X-ray 2.2 C 232-354  L-Bb 
3iag X-ray 2 C 232-354 None
6dks X-ray 2.78 C 232-354 None
6dks X-ray 2.78 G 232-354 None
6dks X-ray 2.78 C 232-354 None
6dks X-ray 2.78 G 232-354 None
5eg6 X-ray 2.09 C 232-354 None


© NPIDB team 2003 - 2021

text