Pfam domain
Pfam family: TIG_SUH (PF20144.1)
Uniprot AC: P31266
RecName: Recombining binding protein suppressor of hairless
Begin-End: 380-470
Organism: Mus musculus
Interaction Mode:   

Sequence:
VPVVESLQLNGGGDVAMLELTGQNFTPNLRVWFGDVEAETMYRCGESMLCVVPDISAFRE
GWRWVRQPVQVPVTLVRNDGVIYSTSLTFTY
Structures of the domain P31266 380-470
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4j2x X-ray 2.85 C 380-470 None
4j2x X-ray 2.85 A 380-470 None
3brg X-ray 2.2 C 380-470 None
3iag X-ray 2 C 380-470 None
6dks X-ray 2.78 C 380-470 None
6dks X-ray 2.78 G 380-470 None
6dks X-ray 2.78 C 380-470 None
6dks X-ray 2.78 G 380-470 None
5eg6 X-ray 2.09 C 380-470 None


© NPIDB team 2003 - 2021

text