Pfam domain
Pfam family: LAG1-DNAbind (PF09271.13)
Uniprot AC: P31266
RecName: Recombining binding protein suppressor of hairless
Begin-End: 74-204
Organism: Mus musculus
Interaction Mode:  L-Bb L-Mj 

Sequence:
VLILHAKVAQKSYGNEKRFFCPPPCVYLMGSGWKKKKEQMERDGCSEQESQPCAFIGIGN
SDQEMQQLNLEGKNYCTAKTLYISDSDKRKHFMLSVKMFYGNSDDIGVFLSKRIKVISKP
SKKKQSLKNAD
Structures of the domain P31266 74-204
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4j2x X-ray 2.85 C 74-204  L-Bb L-Mj 
4j2x X-ray 2.85 A 74-204  L-Bb L-Mj 
3brg X-ray 2.2 C 74-204  L-Bb L-Mj 
3iag X-ray 2 C 74-204  L-Bb L-Mj 
6dks X-ray 2.78 C 74-204  L-Bb L-Mj 
6dks X-ray 2.78 G 74-204  L-Bb L-Mj 
6dks X-ray 2.78 C 74-204  L-Bb L-Mj 
6dks X-ray 2.78 G 74-204  L-Bb L-Mj 
5eg6 X-ray 2.09 C 74-204  L-Bb L-Mj 


© NPIDB team 2003 - 2021

text