Pfam domain
Pfam family: Phage_G (PF02306.14)
Uniprot AC: P31281
RecName: Major spike protein G
Begin-End: 1-187
Organism: Enterobacteria phage alpha3
Interaction Mode:   

Sequence:
MYQNFVTKHDTAIQTSRFSVTGNVIPAAPTGNIPVINGGSITAERAVVNLYANMNVSTSS
DGSFIVAMKVDTSPTDPNCVISAGVNLSFAGTSYPIVGIVRFESASEQPTSIAGSEVEHY
PIEMSVGSGGVCSARDCATVDIHPRTSGNNVFVGVICSSAKWTSGRVIGTIATTQVIHEY
QVLQPLK
Structures of the domain P31281 1-187
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1rb8 X-ray 3.5 G 1-187 None


© NPIDB team 2003 - 2019

text