Pfam domain
Pfam family: Ribosomal_L37e (PF01907.18)
Uniprot AC: P32410
RecName: 50S ribosomal protein L37e
Begin-End: 3-56
Organism: Haloarcula marismortui
Interaction Mode:   

Sequence:
GAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAG
Structures of the domain P32410 3-56
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1vq6 X-ray 2.7 1 3-54 None
1yit X-ray 2.8 1 3-54 None
1yjw X-ray 2.9 1 3-54 None
1vql X-ray 2.3 1 3-54 None
1ffk X-ray 2.4 X 3-54 None
1yhq X-ray 2.4 1 3-54 None
1n8r X-ray 3 2 3-54 None
1vqk X-ray 2.3 1 3-54 None
1vqm X-ray 2.3 1 3-54 None
1kqs X-ray 3.1 Z 3-54 None
1m1k X-ray 3.2 2 3-54 None
1nji X-ray 3 2 3-54 None
3cc4 X-ray 2.7 1 3-54 None
1yjn X-ray 3 1 3-54 None
3ccr X-ray 3 1 3-54 None
1kd1 X-ray 3 2 3-54 None
1vq8 X-ray 2.2 1 3-54 None
1yj9 X-ray 2.9 1 3-54 None
1jj2 X-ray 2.4 Z 3-54 None
3ccv X-ray 2.9 1 3-54 None
1vq9 X-ray 2.4 1 3-54 None
2qa4 X-ray 3 1 3-54 None
1k73 X-ray 3.01 2 3-54 None
1vq5 X-ray 2.6 1 3-54 None
2otl X-ray 2.7 1 3-54 None
3ccj X-ray 3.3 1 3-54 None
1k8a X-ray 3 2 3-54 None
1k9m X-ray 3 2 3-54 None
1yij X-ray 2.6 1 3-54 None
1kc8 X-ray 3.01 2 3-54 None
1s72 X-ray 2.4 1 3-54 None
3cxc X-ray 3 Z 3-54 None
1vqo X-ray 2.2 1 3-54 None
1vqp X-ray 2.25 1 3-54 None
1vqn X-ray 2.4 1 3-54 None
1vq4 X-ray 2.7 1 3-54 None
1yi2 X-ray 2.65 1 3-54 None
3cce X-ray 2.75 1 3-54 None
3ow2 X-ray 2.7 Z 3-54 None
1q7y X-ray 3.2 2 3-54 None
3cc7 X-ray 2.7 1 3-54 None
3cc2 X-ray 2.4 1 3-54 None
2otj X-ray 2.9 1 3-54 None
3cma X-ray 2.8 1 3-54 None
3cme X-ray 2.95 1 3-54 None
3g4s X-ray 3.2 1 3-54 None
3ccq X-ray 2.9 1 3-54 None
2qex X-ray 2.9 1 3-54 None
3ccm X-ray 2.55 1 3-54 None
1m90 X-ray 2.8 2 3-54 None
1w2b X-ray 3.5 Z 3-54 None
3i55 X-ray 3.11 1 3-54 None
1q86 X-ray 3 2 3-54 None
1vq7 X-ray 2.5 1 3-54 None
3ccu X-ray 2.8 1 3-54 None
1q82 X-ray 2.98 2 3-54 None
3i56 X-ray 2.9 1 3-54 None
3g71 X-ray 2.85 1 3-54 None
3g6e X-ray 2.7 1 3-54 None
1qvg X-ray 2.9 Z 3-54 None
1q81 X-ray 2.95 2 3-54 None
3cd6 X-ray 2.75 1 3-54 None
1qvf X-ray 3.1 Z 3-54 None
3ccl X-ray 2.9 1 3-54 None
3cpw X-ray 2.7 Z 3-54 None
3ccs X-ray 2.95 1 3-54 None
4adx X-ray 6.6 1 3-54 None


© NPIDB team 2003 - 2019

text