Pfam domain
Pfam family: GTP_EFTU_D2 (PF03144.24)
Uniprot AC: P32481
RecName: Eukaryotic translation initiation factor 2 subunit gamma
Begin-End: 339-418
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
GGSILNGVFKLGDEIEIRPGIVTKDDKGKIQCKPIFSNIVSLFAEQNDLKFAVPGGLIGV
GTKVDPTLCRADRLVGQVVG
Structures of the domain P32481 339-418
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jaq X-ray 6 k 335-417 None
3j81 X-ray 4 k 339-397 None
3jap X-ray 4.9 k 335-417 None


© NPIDB team 2003 - 2019

text