Pfam domain
Pfam family: eIF2_C (PF09173.10)
Uniprot AC: P32481
RecName: Eukaryotic translation initiation factor 2 subunit gamma
Begin-End: 428-517
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
TDIEINYFLLRRLLGVKTDGQKQAKVRKLEPNEVLMVNIGSTATGARVVAVKADMARLQL
TSPACTEINEKIALSRRIEKHWRLIGWATI
Structures of the domain P32481 428-517
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jaq X-ray 6 k 429-517 None
3j81 X-ray 4 k 429-517 None
3jap X-ray 4.9 k 429-517 None


© NPIDB team 2003 - 2019

text