Pfam domain
Pfam family: GTP_EFTU (PF00009.26)
Uniprot AC: P32481
RecName: Eukaryotic translation initiation factor 2 subunit gamma
Begin-End: 98-304
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
QATINIGTIGHVAHGKSTVVRAISGVQTVRFKDELERNITIKLGYANAKIYKCQEPTCPE
PDCYRSFKSDKEISPKCQRPGCPGRYKLVRHVSFVDCPGHDILMSTMLSGAAVMDAALLL
IAGNESCPQPQTSEHLAAIEIMKLKHVIILQNKVDLMREESALEHQKSILKFIRGTIADG
APIVPISAQLKYNIDAVNEFIVKTIPV
Structures of the domain P32481 98-304
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jaq X-ray 6 k 100-303 None
3j81 X-ray 4 k 100-303 None
3jap X-ray 4.9 k 100-303 None


© NPIDB team 2003 - 2019

text