Pfam domain
Pfam family: eIF-3c_N (PF05470.11)
Uniprot AC: P32497
RecName: Eukaryotic translation initiation factor 3 subunit C
Begin-End: 251-640
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
QEDFFTRLQTIIDSRGKKTVNQQSLISTLEELLTVAEKPYEFIMAYLTLIPSRFDASANL
SYQPIDQWKSSFNDISKLLSILDQTIDTYQVNEFADPIDFIEDEPKEDSDGVKRILGSIF
SFVERLDDEFMKSLLNIDPHSSDYLIRLRDEQSIYNLILRTQLYFEATLKDEHDLERALT
RPFVKRLDHIYYKSENLIKIMETAAWNIIPAQFKSKFTSKDQLDSADYVDNLIDGLSTIL
SKQNNIAVQKRAILYNIYYTALNKDFQTAKDMLLTSQVQTNINQFDSSLQILFNRVVVQL
GLSAFKLCLIEECHQILNDLLSSSHLREILGQQSLHRISLNSSNNASADERARQCLPYHQ
HINLDLIDVVFLTCSLLIEIPRMTAFYSGI
Structures of the domain P32497 251-640
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jap X-ray 4.9 p 218-639 None


© NPIDB team 2003 - 2020

text