Pfam domain
Pfam family: PCI (PF01399.26)
Uniprot AC: P32497
RecName: Eukaryotic translation initiation factor 3 subunit C
Begin-End: 650-780
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
KSIRRSLEHYDKLSFQGPPETLRDYVLFAAKSMQKGNWRDSVKYLREIKSWALLPNMETV
LNSLTERVQVESLKTYFFSFKRFYSSFSVAKLAELFDLPENKVVEVLQSVIAELEIPAKL
NDEKTIFVVEK
Structures of the domain P32497 650-780
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jap X-ray 4.9 p 651-780 None


© NPIDB team 2003 - 2020

text