Pfam domain
Pfam family: NDC10_II (PF16787.7)
Uniprot AC: P32504
RecName: Centromere DNA-binding protein complex CBF3 subunit A
Begin-End: 185-496
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
LLKVSLNLWNPETNHLSEKFFKTCSEKLRFLVDFQLRSYLNLSFEERSKIRFGSLKLGKR
DRDAIIYHKVTHSAEKKDTPGHHQLLALLPQDCPFICPQTTLAAYLYLRFYGIPSVSKGD
GFPNLNADENGSLLQDIPILRGKSLTTYPREETFSNYYTTVFRYCHLPYKRREYFNKCNL
VYPTWDEDTFRTFFNEENHGNWLEQPEAFAFPDKIPFDFKKIMNFKSPYTSYSTNAKKDP
FPPPKDLLVQIFPEIDEYKRHDYEGLSQNSRDFLDLMEVLRERFLSNLPWIYKFFPNHDI
FQDPIFGNSDFQ
Structures of the domain P32504 185-496
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6gys X-ray 4.4 L 185-496  H-Bb L-Bb 
6gys X-ray 4.4 E 185-496  H-Bb L-Bb 


© NPIDB team 2003 - 2021

text