Pfam domain
Pfam family: RNA_POL_M_15KD (PF02150.15)
Uniprot AC: P32529
RecName: DNA-directed RNA polymerase I subunit RPA12
Begin-End: 7-42
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
LIFCLDCGDLLENPNAVLGSNVECSQCKAIYPKSQF
Structures of the domain P32529 7-42
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5w65 X-ray 4.3 I 7-42 None
5w5y X-ray 3.8 I 7-42 None
5w66 X-ray 3.9 I 7-42 None
5m5x X-ray 4 I 7-42 None
5m5y X-ray 4 I 7-42 None
5w64 X-ray 4.2 I 7-42 None
5oa1 X-ray 4.4 I 7-42 None
5m3f X-ray 3.8 I 7-42 None


© NPIDB team 2003 - 2019

text