Pfam domain
Pfam family: TFIIS_C (PF01096.17)
Uniprot AC: P32529
RecName: DNA-directed RNA polymerase I subunit RPA12
Begin-End: 84-122
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
EKCPQCGNEEMNYHTLQLRSADEGATVFYTCTSCGYKFR
Structures of the domain P32529 84-122
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5oa1 X-ray 4.4 I 85-122 None


© NPIDB team 2003 - 2019

text