Pfam domain
Pfam family: TFIIS_C (PF01096.20)
Uniprot AC: P32529
RecName: DNA-directed RNA polymerase I subunit RPA12
Begin-End: 84-122
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
EKCPQCGNEEMNYHTLQLRSADEGATVFYTCTSCGYKFR
Structures of the domain P32529 84-122
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6ruo X-ray 3.5 I 84-122 None
6rrd X-ray 3.1 I 84-122 None
6rql X-ray 2.9 I 84-122 None
5oa1 X-ray 4.4 I 84-122 None
6rqh X-ray 3.7 I 84-122 None
6rwe X-ray 3 I 84-122 None
6hlq X-ray 3.18 I 84-122 None
6rui X-ray 2.7 I 84-122 None


© NPIDB team 2003 - 2021

text