Pfam domain
Pfam family: Med22 (PF06179.11)
Uniprot AC: P32570
RecName: Mediator of RNA polymerase II transcription subunit 22
Begin-End: 8-117
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
EKLEQTRTILSVKLAELINMTTIADRNDDDEGSFAQENSELAVATTSVMMVNNQTMQLIK
NVQDLLILTRSIKEKWLLNQIPVTEHSKVTRFDEKQIEELLDNCIETFVA
Structures of the domain P32570 8-117
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4v1o X-ray 9.7 Z 8-100 None
5sva X-ray 15.3 S 8-86 None


© NPIDB team 2003 - 2019

text