Pfam domain
Pfam family: DEAD (PF00270.28)
Uniprot AC: P32639
RecName: Pre-mRNA-splicing helicase BRR2
Begin-End: 500-680
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
NPIQSKVFHAAFEGDSNMLICAPTGSGKTNIALLTVLKALSHHYNPKTKKLNLSAFKIVY
IAPLKALVQEQVREFQRRLAFLGIKVAELTGDSRLSRKQIDETQVLVSTPEKWDITTRNS
NNLAIVELVRLLIIDEIHLLHDDRGPVLESIVARTFWASKYGQEYPRIIGLSATLPNYED
V
Structures of the domain P32639 500-680
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5lj5 X-ray 3.8 B 82-677 None
3jcm X-ray 3.8 N 501-677 None
5gao X-ray 3.6 B 501-677 None


© NPIDB team 2003 - 2020

text