Pfam domain
Pfam family: Helicase_C (PF00271.30)
Uniprot AC: P32639
RecName: Pre-mRNA-splicing helicase BRR2
Begin-End: 721-879
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
AMNDACYEKVLESINEGNQIIVFVHSRKETSRTATWLKNKFAEENITHKLTKNDAGSKQI
LKTEAANVLDPSLRKLIESGIGTHHAGLTRSDRSLSEDLFADGLLQVLVCTATLAWGVNL
PAHTVIIKGTDVYSPEKGSWEQLSPQDVLQMLGRAGRPR
Structures of the domain P32639 721-879
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5lj5 X-ray 3.8 B 727-877 None
3jcm X-ray 3.8 N 727-877 None
5gao X-ray 3.6 B 727-877 None


© NPIDB team 2003 - 2019

text