Pfam domain
Pfam family: Sec63 (PF02889.15)
Uniprot AC: P32639
RecName: Pre-mRNA-splicing helicase BRR2
Begin-End: 998-1307
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
ATDLGNIASSFYINHASMDVYNRELDEHTTQIDLFRIFSMSEEFKYVSVRYEEKRELKQL
LEKAPIPIREDIDDPLAKVNVLLQSYFSQLKFEGFALNSDIVFIHQNAGRLLRAMFEICL
KRGWGHPTRMLLNLCKSATTKMWPTNCPLRQFKTCPVEVIKRLEASTVPWGDYLQLETPA
EVGRAIRSEKYGKQVYDLLKRFPKMSVTCNAQPITRSVMRFNIEIIADWIWDMNVHGSLE
PFLLMLEDTDGDSILYYDVLFITPDIVGHEFTLSFTYELKQHNQNNLPPNFFLTLISENW
WHSEFEIPVS
Structures of the domain P32639 998-1307
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5lj5 X-ray 3.8 B 998-1306 None
3jcm X-ray 3.8 N 998-1306 None
5gao X-ray 3.6 B 998-1306 None


© NPIDB team 2003 - 2019

text