Pfam domain
Pfam family: Helicase_C (PF00271.30)
Uniprot AC: P32657
RecName: Chromo domain-containing protein 1
Begin-End: 695-809
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
GKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISI
DHFNSPDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIG
Structures of the domain P32657 695-809
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5o9g X-ray 4.8 W 698-809 None


© NPIDB team 2003 - 2019

text