Pfam domain
Pfam family: TFIIA_gamma_C (PF02751.13)
Uniprot AC: P32774
RecName: Transcription initiation factor IIA subunit 2
Begin-End: 61-118
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
TVKGNLDTYGFCDDVWTFIVKNCQVTVEDSHRDASQNGSGDSQSVISVDKLRIVACNS
Structures of the domain P32774 61-118
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1ytf X-ray 2.5 D 56-118 None
1rm1 X-ray 2.5 B 56-118 None
1nh2 X-ray 1.9 D 56-118 None
5fmf X-ray 6 O 56-118 None
5oqj X-ray 4.7 V 56-118 None
5sva X-ray 15.3 e 54-100 None
5fyw X-ray 4.35 V 56-118 None


© NPIDB team 2003 - 2019

text