Pfam domain
Pfam family: Rrn6 (PF10214.11)
Uniprot AC: P32786
RecName: RNA polymerase I-specific transcription initiation factor RRN6
Begin-End: 175-780
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
DPTVANRLDSQYIQTASDLRNYRDGTEIIAYASGKTGSVLNIAVLTRQNTLHLNRHNNVT
SIELHSPIKSIKIPGASESIGRRSNLVGIITENSFQIFRIESVHSRSCDVMVSSSEPLYF
VEIDDLQVVDFAFNPWDLQQFAIIDIKGNWSIGRIPKNFNNNNKRKLQLIDNLHGTIFDP
EELSSWKRIEWFSHFQKILVFDRSKMIEIDFMNNWQTEVVQAKAWSNIRDYKRIDDKNGI
LLTSREIIIVGASESNDPVRRISWKHDLDPDDTTLRITVQKVKKPDHILLVAFVYSMRHK
RIYMHVFSHRKANLFQSLGCSTVLEIPGGTPTGIETILTLDHIDDESRREEDADENFELV
VDFLVKLRNSSEVYYYALSNTQNSEPNKQETPIIVDHPEWASLFNNADEREKESIGALVS
QIKLKERERISRVQNLIEHENSHDEDKYLQDLGYRLSIATNELLESWQKTKDESILSGSL
SHSKLKNLLENSDSFASIPEFSSLLDQFFQYYQDQDVTFIGFEKLLHLFLHEDVPGLDIF
YNKLLQCWVLVSPQAELLTKEIVKDIIWSLARLEKPSLFEPIQNEISRSLSGPYQDIISS
WDMDDI
Structures of the domain P32786 175-780
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5w5y X-ray 3.8 O 175-780 None
6ruo X-ray 3.5 S 175-779 None
6rrd X-ray 3.1 S 175-779 None
6rql X-ray 2.9 S 175-779 None
5w66 X-ray 3.9 O 175-780 None
5w65 X-ray 4.3 O 175-780 None
6rqh X-ray 3.7 S 175-779 None
6rwe X-ray 3 S 175-779 None
6rui X-ray 2.7 S 175-779 None
5w64 X-ray 4.2 O 175-780 None


© NPIDB team 2003 - 2021

text