Pfam domain
Pfam family: Rrn6 (PF10214.8)
Uniprot AC: P32786
RecName: RNA polymerase I-specific transcription initiation factor RRN6
Begin-End: 178-554
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
VANRLDSQYIQTASDLRNYRDGTEIIAYASGKTGSVLNIAVLTRQNTLHLNRHNNVTSIE
LHSPIKSIKIPGASESIGRRSNLVGIITENSFQIFRIESVHSRSCDVMVSSSEPLYFVEI
DDLQVVDFAFNPWDLQQFAIIDIKGNWSIGRIPKNFNNNNKRKLQLIDNLHGTIFDPEEL
SSWKRIEWFSHFQKILVFDRSKMIEIDFMNNWQTEVVQAKAWSNIRDYKRIDDKNGILLT
SREIIIVGASESNDPVRRISWKHDLDPDDTTLRITVQKVKKPDHILLVAFVYSMRHKRIY
MHVFSHRKANLFQSLGCSTVLEIPGGTPTGIETILTLDHIDDESRREEDADENFELVVDF
LVKLRNSSEVYYYALSN
Structures of the domain P32786 178-554
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5oa1 X-ray 4.4 V 217-499 None


© NPIDB team 2003 - 2019

text