Pfam domain
Pfam family: Ku_N (PF03731.14)
Uniprot AC: P32807
RecName: ATP-dependent DNA helicase II subunit 1
Begin-End: 31-267
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
GILFCIELSETMFKESSDLEYKSPLLEILESLDELMSQLVITRPGTAIGCYFYYCNREDA
KEGIYELFPLRDINATFMKKLNDLLEDLSSGRISLYDYFMFQQTGSEKQVRLSVLFTFML
DTFLEEIPGQKQLSNKRVFLFTDIDKPQEAQDIDERARLRRLTIDLFDNKVNFATFFIGY
ADKPFDNEFYSDILQLGSHTNENTGLDSEFDGPSTKPIDAKYIKSRILRKKEVKRIM
Structures of the domain P32807 31-267
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5y58 X-ray 2.8 A 32-267 None
5y58 X-ray 2.8 C 32-267 None
5y58 X-ray 2.8 E 32-267 None


© NPIDB team 2003 - 2019

text