Pfam domain
Pfam family: ORC2 (PF04084.13)
Uniprot AC: P32833
RecName: Origin recognition complex subunit 2
Begin-End: 268-608
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
DVTREEFSLVSNFFNENFQKRPRQKLFEIQKKMFPQYWFELTQGFSLLFYGVGSKRNFLE
EFAIDYLSPKIAYSQLAYENELQQNKPVNSIPCLILNGYNPSCNYRDVFKEITDLLVPAE
LTRSETKYWGNHVILQIQKMIDFYKNQPLDIKLILVVHNLDGPSIRKNTFQTMLSFLSVI
RQIAIVASTDHIYAPLLWDNMKAQNYNFVFHDISNFEPSTVESTFQDVMKMGKSDTSSGA
EGAKYVLQSLTVNSKKMYKLLIETQMQNMGNLSANTGPKRGTQRTGVELKLFNHLCAADF
IASNEIALRSMLREFIEHKMANITKNNSGMEIIWVPYTYAE
Structures of the domain P32833 268-608
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5udb X-ray 3.9 B 270-607 None
5v8f X-ray 3.9 B 270-607 None


© NPIDB team 2003 - 2019

text