Pfam domain
Pfam family: Ribosomal_S2 (PF00318.19)
Uniprot AC: P32905
RecName: 40S ribosomal protein S0-A
Begin-End: 111-183
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
ITRSFKEPRLVIVTDPRSDAQAIKEASYVNIPVIALTDLDSPSEFVDVAIPCNNRGKHSI
GLIWYLLAREVLR
Structures of the domain P32905 111-183
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fai X-ray 3.4 A 116-181 None
6eml X-ray 3.6 P 116-181 None


© NPIDB team 2003 - 2019

text