Pfam domain
Pfam family: SUI1 (PF01253.21)
Uniprot AC: P32911
RecName: Eukaryotic translation initiation factor eIF-1
Begin-End: 23-99
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
SNYIHIRIQQRNGRKTLTTVQGVPEEYDLKRILKVLKKDFACNGNIVKDPEMGEIIQLQG
DQRAKVCEFMISQLGLQ
Structures of the domain P32911 23-99
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3j80 X-ray 3.75 j 3-77 None
3jam X-ray 3.46 j 24-98 None
3jaq X-ray 6 m 24-98 None
3j81 X-ray 4 m 24-98 None
3jap X-ray 4.9 m 22-97 None


© NPIDB team 2003 - 2019

text