Pfam domain
Pfam family: Ribosomal_L10 (PF00466.19)
Uniprot AC: P33201
RecName: Ribosome assembly factor MRT4
Begin-End: 18-120
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
KGRENKERIFDEVREALDTYRYVWVLHLDDVRTPVLQEIRTSWAGSKLIMGKRKVLQKAL
GEKREEEYKENLYQLSKLCSGVTGLLFTDEDVNTVKEYFKSYV
Structures of the domain P33201 18-120
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6em5 X-ray 4.3 W 40-140 None


© NPIDB team 2003 - 2019

text