Pfam domain
Pfam family: zf-C4 (PF00105.17)
Uniprot AC: P33242
RecName: Steroidogenic factor 1
Begin-End: 11-80
Organism: Mus musculus
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb 

Sequence:
ELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKHYTCTESQSCKIDKTQRKRCPFCRF
QKCLTVGMRL
Structures of the domain P33242 11-80
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2ff0 NMR A 12-79  H-Bb H-Mj S-Bb L-Bb 


© NPIDB team 2003 - 2019

text