Pfam domain
Pfam family: PRO8NT (PF08082.10)
Uniprot AC: P33334
RecName: Pre-mRNA-splicing factor 8
Begin-End: 131-282
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
KAEMPPEHLRKIINTHSDMASKMYNTDKKAFLGALKYLPHAILKLLENMPHPWEQAKEVK
VLYHTSGAITFVNETPRVIEPVYTAQWSATWIAMRREKRDRTHFKRMRFPPFDDDEPPLS
YEQHIENIEPLDPINLPLDSQDDEYVKDWLYD
Structures of the domain P33334 131-282
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5wsg X-ray 4 A 131-282 None
5gmk X-ray 3.4 A 33-282 None
6bk8 X-ray 3.3 A 20-282 None
5lj3 X-ray 3.8 A 131-282 None
5mps X-ray 3.85 A 80-282 None
5lj5 X-ray 3.8 A 131-282 None
3jcm X-ray 3.8 A 131-282 None
5gam X-ray 3.7 A 131-282 None


© NPIDB team 2003 - 2020

text