Pfam domain
Pfam family: PRP8_domainIV (PF12134.7)
Uniprot AC: P33334
RecName: Pre-mRNA-splicing factor 8
Begin-End: 1832-2061
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
EPFLNSSNYAELFNNDIKLFVDDTNVYRVTVHKTFEGNVATKAINGCIFTLNPKTGHLFL
KIIHTSVWAGQKRLSQLAKWKTAEEVSALVRSLPKEEQPKQIIVTRKAMLDPLEVHMLDF
PNIAIRPTELRLPFSAAMSIDKLSDVVMKATEPQMVLFNIYDDWLDRISSYTAFSRLTLL
LRALKTNEESAKMILLSDPTITIKSYHLWPSFTDEQWITIESQMRDLILT
Structures of the domain P33334 1832-2061
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6bk8 X-ray 3.3 A 1832-2060 None
5mps X-ray 3.85 A 1832-2060 None
3jcm X-ray 3.8 A 1832-2060 None
5gap X-ray 3.6 A 1832-2060 None


© NPIDB team 2003 - 2019

text