Pfam domain
Pfam family: PRP8_domainIV (PF12134.7)
Uniprot AC: P33334
RecName: Pre-mRNA-splicing factor 8
Begin-End: 1840-2061
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
YAELFNNDIKLFVDDTNVYRVTVHKTFEGNVATKAINGCIFTLNPKTGHLFLKIIHTSVW
AGQKRLSQLAKWKTAEEVSALVRSLPKEEQPKQIIVTRKAMLDPLEVHMLDFPNIAIRPT
ELRLPFSAAMSIDKLSDVVMKATEPQMVLFNIYDDWLDRISSYTAFSRLTLLLRALKTNE
ESAKMILLSDPTITIKSYHLWPSFTDEQWITIESQMRDLILT
Structures of the domain P33334 1840-2061
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5wsg X-ray 4 A 1827-2060 None
5gmk X-ray 3.4 A 1827-2060 None
5lj3 X-ray 3.8 A 1827-2060 None
5lj5 X-ray 3.8 A 1827-2060 None


© NPIDB team 2003 - 2019

text