Pfam domain
Pfam family: PROCT (PF08084.10)
Uniprot AC: P33334
RecName: Pre-mRNA-splicing factor 8
Begin-End: 2289-2395
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
IDISIFSTPGSVSLSAYNLTDEGYQWGEENKDIMNVLSEGFEPTFSTHAQLLLSDRITGN
FIIPSGNVWNYTFMGTAFNQEGDYNFKYGIPLEFYNEMHRPVHFLQF
Structures of the domain P33334 2289-2395
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5lj5 X-ray 3.8 A 2289-2395 None
3jcm X-ray 3.8 A 2289-2395 None


© NPIDB team 2003 - 2020

text