Pfam domain
Pfam family: PROCN (PF08083.10)
Uniprot AC: P33334
RecName: Pre-mRNA-splicing factor 8
Begin-End: 470-874
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
LPNTKDAMSLYHSPFPFNRTKGKMVRAQDVALAKKWFLQHPDEEYPVKVKVSYQKLLKNY
VLNELHPTLPTNHNKTKLLKSLKNTKYFQQTTIDWVEAGLQLCRQGHNMLNLLIHRKGLT
YLHLDYNFNLKPTKTLTTKERKKSRLGNSFHLMRELLKMMKLIVDTHVQFRLGNVDAFQL
ADGIHYILNHIGQLTGIYRYKYKVMHQIRACKDLKHIIYYKFNKNLGKGPGCGFWQPAWR
VWLNFLRGTIPLLERYIGNLITRQFEGRSNEIVKTTTKQRLDAYYDLELRNSVMDDILEM
MPESIRQKKARTILQHLSEAWRCWKANIPWDVPGMPAPIKKIIERYIKSKADAWVSAAHY
NRERIKRGAHVEKTMVKKNLGRLTRLWIKNEQERQRQIQKNGPEI
Structures of the domain P33334 470-874
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5wsg X-ray 4 A 472-874 None
5gmk X-ray 3.4 A 472-874 None
6bk8 X-ray 3.3 A 472-874 None
5lj3 X-ray 3.8 A 472-874 None
5mps X-ray 3.85 A 472-874 None
5lj5 X-ray 3.8 A 472-874 None
3jcm X-ray 3.8 A 472-874 None


© NPIDB team 2003 - 2020

text