Pfam domain
Pfam family: Ribosomal_S3Ae (PF01015.17)
Uniprot AC: P33442
RecName: 40S ribosomal protein S1-A
Begin-End: 20-221
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
VVDPFTRKEWFDIKAPSTFENRNVGKTLVNKSTGLKSASDALKGRVVEVCLADLQGSEDH
SFRKIKLRVDEVQGKNLLTNFHGMDFTTDKLRSMVRKWQTLIEANVTVKTSDDYVLRIFA
IAFTRKQANQVKRHSYAQSSHIRAIRKVISEILTKEVQGSTLAQLTSKLIPEVINKEIEN
ATKDIFPLQNIHVRKVKLLKQP
Structures of the domain P33442 20-221
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fai X-ray 3.4 B 20-221 None
6eml X-ray 3.6 Q 20-221 None


© NPIDB team 2003 - 2019

text