Pfam domain
Pfam family: zf-C4 (PF00105.17)
Uniprot AC: P34021
RecName: Ecdysone receptor
Begin-End: 262-331
Organism: Drosophila melanogaster
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb 

Sequence:
ELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKSAVYCCKFGRACEMDMYMRRKCQECRL
KKCLAVGMRP
Structures of the domain P34021 262-331
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1r0n X-ray 2.6 B 200-267  H-Bb H-Mj S-Bb L-Bb 
1r0o X-ray 2.24 B 6-73 None
2han X-ray 1.95 B 6-73  H-Bb H-Mj S-Bb L-Bb 


© NPIDB team 2003 - 2019

text