Pfam domain
Pfam family: LTV (PF04180.13)
Uniprot AC: P34078
RecName: Protein LTV1
Begin-End: 360-405
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
QYDQIINGYENYEEELEEDEEQNYQPFDMSAERSDFESMLDDFLDN
Structures of the domain P34078 360-405
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fai X-ray 3.4 j 2-47 None


© NPIDB team 2003 - 2019

text