Pfam domain
Pfam family: SHS2_Rpb7-N (PF03876.16)
Uniprot AC: P34087
RecName: DNA-directed RNA polymerase II subunit RPB7
Begin-End: 8-79
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
SLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGS
AEFNVKYRAVVF
Structures of the domain P34087 8-79
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3hox X-ray 3.65 G 9-79 None
3hoy X-ray 3.4 G 9-79 None
3hoz X-ray 3.65 G 9-79 None
4a3j X-ray 3.7 G 9-79 None
1y1w X-ray 4 G 9-79 None
2ja6 X-ray 4 G 9-79 None
1y1y X-ray 4 G 9-79 None
2vum X-ray 3.4 G 9-79 None
2r7z X-ray 3.8 G 9-79 None
2b63 X-ray 3.8 G 9-79 None
3po2 X-ray 3.3 G 9-79 None
2ja7 X-ray 3.8 S 9-79 None
2ja7 X-ray 3.8 G 9-79 None
1y77 X-ray 4.5 G 9-79 None
3hou X-ray 3.2 G 9-79 None
3hou X-ray 3.2 S 9-79 None
3hov X-ray 3.5 G 9-79 None
3i4n X-ray 3.9 G 9-79 None
3how X-ray 3.6 G 9-79 None
3i4m X-ray 3.7 G 9-79 None
4bbs X-ray 3.6 G 9-79 None
5c44 X-ray 3.95 G 9-79 None
5fmf X-ray 6 G 9-79 None
5c3e X-ray 3.7 G 9-79 None
5c4x X-ray 4 G 9-79 None
2ja8 X-ray 3.8 G 9-79 None
5c4a X-ray 4.2 G 11-79 None
2ja5 X-ray 3.8 G 9-79 None
2r93 X-ray 4 G 9-79 None
4v1o X-ray 9.7 G 9-79 None
3h3v X-ray 4 H 9-79 None
3po3 X-ray 3.3 G 9-79 None
2r92 X-ray 3.8 G 9-79 None
5vvs X-ray 6.4 G 9-79 None
5oqj X-ray 4.7 G 9-79 None
5vvr X-ray 5.8 G 9-79 None
5sva X-ray 15.3 G 62-133 None
5fyw X-ray 4.35 G 9-79 None


© NPIDB team 2003 - 2019

text