Pfam domain
Pfam family: Ribosomal_L3 (PF00297.21)
Uniprot AC: P34113
RecName: 60S ribosomal protein L3
Begin-End: 1-374
Organism: Dictyostelium discoideum
Interaction Mode:   

Sequence:
MSHRKFEAPRHGNLGFRPRKRAARHQGKVKSFPKDDRTQKVHLTAFMGYKAGMTHVVRDL
EKPGSKMHKKEIVEAVTIIECPPMYIVGLVGYVETAQGLKTYKTVWAQHLSDNFRRRLYK
NWYKSKSKKAFTKYVKQYETEEGKKSIEASLQAIKKRCSVVRVIAHTQVHKLKLTQKKAH
VLEIQVNGGSIVEKVNFAVANFEKTVNVTGVFAENELIDVIGVTKGKGFNGVIKRWGVRK
LPRKTHKGLRKVACIGAWHPSRVSTTVPRAGQLGYHHRVERNKKIYRIGQAQPEDGKQIS
TGKTEFDLTEKTINPMGGFAHYGMVKHEFLMLKGCVAGPRKRALTLRKSITTQTGRAALE
KITLKFIDTSSKFG
Structures of the domain P34113 1-374
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5anb X-ray 4.1 A 1-374 None
5anc X-ray 4.2 A 1-374 None
5an9 X-ray 3.3 A 1-374 None


© NPIDB team 2003 - 2019

text