Pfam domain
Pfam family: Nop52 (PF05997.11)
Uniprot AC: P35178
RecName: Ribosomal RNA-processing protein 1
Begin-End: 4-243
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
SNFVKQLSSNNRKTRVNALEALKKYLTAKQFKENKQIEFNKLWKGLYYAMWFSDRPRPQQ
RLANELGELHGLYFDPKDNSTADELTTNDKAFIKFSRGFWKVMCFEWFNIDRYRLDKYLL
LIRRVLFSQLKYLQSRNWDKKLVDEYIKKVLRWLPLSGSPKVYTGIPIHIVDILLDEWER
LLKDGDEDDEDEENKEEEMRKIAESAKKTPLADVIAIFQDIVADYNNSKVLREKIKEDLF
Structures of the domain P35178 4-243
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6em4 X-ray 4.1 4 6-243 None
6em3 X-ray 3.2 4 6-243 None
6em5 X-ray 4.3 4 6-243 None


© NPIDB team 2003 - 2019

text