Pfam domain
Pfam family: TFIIF_alpha (PF05793.11)
Uniprot AC: P35269
RecName: General transcription factor IIF subunit 1
Begin-End: 5-180
Organism: Homo sapiens
Interaction Mode:  H-Bb 

Sequence:
GPSSQNVTEYVVRVPKNTTKKYNIMAFNAADKVNFATWNQARLERDLSNKKIYQEEEMPE
SGAGSEFNRKLREEARRKKYGIVLKEFRPEDQPWLLRVNGKSGRKFKGIKKGGVTENTSY
YIFTQCPDGAFEAFPVHNWYNFTPLARHRTLTAEEAEEEWERRNKVLNHFSIMQQR
Structures of the domain P35269 5-180
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5iy7 X-ray 8.6 S 54-180 None
5iya X-ray 5.4 S 54-180  H-Bb 
5iy8 X-ray 7.9 S 54-180 None
5iyd X-ray 3.9 S 54-180 None
5iy6 X-ray 7.2 S 54-180  H-Bb 
5iyc X-ray 3.9 S 54-180 None
5iy9 X-ray 6.3 S 54-180 None
5iyb X-ray 3.9 S 54-180 None


© NPIDB team 2003 - 2019

text