Pfam domain
Pfam family: rve (PF00665.25)
Uniprot AC: P35956
RecName: Gag-Pol polyprotein
Begin-End: 1285-1372
Organism: Maedi visna virus
Interaction Mode:   

Sequence:
IDHWQVDYTHYEDKIILVWVETNSGLIYAERVKGETGQEFRVQTMKWYAMFAPKSLQSDN
GPAFVAESTQLLMKYLGIEHTTGIPWNP
Structures of the domain P35956 1285-1372
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5m0q X-ray 4.91 P 61-163 None
5m0q X-ray 4.91 A 61-163  H-Bb 
5m0q X-ray 4.91 B 61-163 None
5m0q X-ray 4.91 C 60-163 None
5m0q X-ray 4.91 D 61-163 None
5m0q X-ray 4.91 E 61-163 None
5m0q X-ray 4.91 F 61-163 None
5m0q X-ray 4.91 G 48-163 None
5m0q X-ray 4.91 H 61-163 None
5m0q X-ray 4.91 I 61-163  H-Bb 
5m0q X-ray 4.91 J 61-163 None
5m0q X-ray 4.91 K 60-163 None
5m0q X-ray 4.91 L 61-163 None
5m0q X-ray 4.91 M 61-163 None
5m0q X-ray 4.91 N 61-163 None
5m0q X-ray 4.91 O 48-163 None
5m0r X-ray 8.2 K 60-163 None
5m0r X-ray 8.2 I 61-163  H-Bb H-Mj H-Mn S-Bb S-Mn 
5m0r X-ray 8.2 J 61-163 None
5m0r X-ray 8.2 H 61-163 None
5m0r X-ray 8.2 A 61-163  H-Bb H-Mn S-Bb S-Mj L-Bb 
5m0r X-ray 8.2 B 61-163 None
5m0r X-ray 8.2 C 60-163 None
5m0r X-ray 8.2 D 61-163 None
5m0r X-ray 8.2 E 61-163 None
5m0r X-ray 8.2 F 61-163 None
5m0r X-ray 8.2 G 48-163 None
5m0r X-ray 8.2 L 61-163 None
5m0r X-ray 8.2 M 61-163 None
5m0r X-ray 8.2 N 61-163 None
5m0r X-ray 8.2 O 48-163 None
5m0r X-ray 8.2 P 61-163 None


© NPIDB team 2003 - 2021

text