Pfam domain
Pfam family: Ribosomal_S27e (PF01667.16)
Uniprot AC: P35997
RecName: 40S ribosomal protein S27-A
Begin-End: 28-82
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
PRSYFLDVKCPGCLNITTVFSHAQTAVTCESCSTILCTPTGGKAKLSEGTSFRRK
Structures of the domain P35997 28-82
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fai X-ray 3.4 b 46-100 None
6eml X-ray 3.6 f 28-82 None


© NPIDB team 2003 - 2019

text